Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

4,531 – 4,545 of 115,743 results

4,531

Invitrogen™ Heparin, Fluorescein Conjugate

Shows heparin binding in cells and tissue

Pricing & Availability

4,532

MilliporeSigma™ Sphingomyelinase, Staphylococcus aureus, Protein

Pricing & Availability

4,533

MP Biomedicals™ Glucagon, Human

Pricing & Availability

4,534

MP Biomedicals™ Proteinase K

Suitable for both protein and nucleic acid isolation

Pricing & Availability
Specifications

Purification Method	Chromatography
Form	Lyophilized
pH Range	7.5 to 12
Molecular Weight (g/mol)	∽30
Storage Requirements	4°C
For Use With (Application)	Protein Structure Analysis
Source	Tritirachium album Limber
Name	Proteinase K

4,535

Invitrogen™ Human PDGF-AA Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	≥95%
Conjugate	Unconjugated
Form	Lyophilized
Molecular Weight (g/mol)	14.4 kDa
Common Name	PDGF-AA
Gene Symbol	Pdgfa
Activity	ED50 ≤50 ng/mL; determined by the dose-dependent proliferation of mouse 3T3 indicator cells.
Endotoxin Concentration	≤0.1 EU/μg
Storage Requirements	-20°C, Avoid Freeze/Thaw Cycles
Sequence	MSIEEAVPAV CKTRTVIYEI PRSQVDPTSA NFLIWPPCVE VKRCTGCCNT SSVKCQPSRV HHRSVKVAKV EYVRKKPKLK EVQVRLEEHL ECACATTSLN PDYREEDTGR PRESGKKRKR KRLKPT
Concentration	0.1 mg/mL
Expression System	E. coli
For Use With (Application)	Control,Bioactivity
Name	Human PDGF-AA
Accession Number	P04085
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	H-PDGF-AA; PDGF A-chain; PDGF subunit A; PDGF1; PDGF-1; Pdgfa; PDGF-A; PDGFACP; platelet derived growth factor subunit A; platelet derived growth factor, alpha; Platelet-derived growth factor A chain; platelet-derived growth factor A-chain; platelet-derived growth factor alpha chain; platelet-derived growth factor alpha polypeptide; Platelet-derived growth factor subunit A; Rpa1
Product Type	Protein
Gene ID (Entrez)	5154
Formulation	0.1% TFA with no preservative
Recombinant	Recombinant

4,536

Novus Biologicals™ Recombinant Mouse DDT Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>95%, by SDS-PAGE
Molecular Weight (g/mol)	15.5 kDa
Gene ID (Entrez)	1652
Formulation	20mM Tris-Hcl buffer (pH8.0) containing 10% glycerol
Gene Symbol	DDT
Storage Requirements	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Concentration	1 mg/ml
Cross Reactivity	DDT
For Use With (Application)	SDS-PAGE
Species	Mouse
Source	E. coli

4,537

Novus Biologicals™ Recombinant Human GPT His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

4,538

R&D Systems™ Recombinant Human/Mouse Wnt-5a Biotinylated Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability

4,539

R&D Systems™ Recombinant Human Tie-2 His-tag Protein

Carrier Free Recombinant Protein

Pricing & Availability

4,540

Novus Biologicals™ Recombinant Human PRAT4B/CNPY4 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>85%, by SDS-PAGE
Conjugate	Unconjugated
Gene Alias	canopy 4 homolog (zebrafish), MGC40499PRAT4BPRotein Associated with Tlr4, protein canopy homolog 4
Common Name	PRAT4B/CNPY4
Molecular Weight (g/mol)	TMW: 28.6kDa
Gene ID (Entrez)	245812
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl, 50% glycerol, 5mM DTT, 2mM EDTA
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

4,541

Novus Biologicals™ Recombinant Human Kallikrein 15 Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Conjugate	Unconjugated
Molecular Weight (g/mol)	27.4 kDa
Gene Symbol	KLK15
Endotoxin Concentration	<1.0 EU per 1μg of protein (determined by LAL method)
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	SDS-PAGE
Source	Baculovirus
Name	Recombinant Human Kallikrein 15 Protein
Regulatory Status	RUO
Purification Method	>90%, by SDS-PAGE
Gene Alias	ACO, ACO protease, EC 3.4.21, EC 3.4.21.-, EC 3.4.21.4, HSRNASPH, kallikrein 15, kallikrein-15, kallikrein-like serine protease, kallikrein-related peptidase 15, prostinogen
Product Type	Recombinant Protein
Gene ID (Entrez)	55554
Formulation	Liquid. PBS (pH 7.4) containing 10% glycerol
Cross Reactivity	Human
Recombinant	Recombinant

4,542

R&D Systems™ Recombinant Human IL-9 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability
Specifications

Purity or Quality Grade	>90%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie Blue Staining
Conjugate	Unconjugated
Common Name	Cytokine P40; HP40; IL9; IL-9; IL-9homolog of mouse T cell and mast cell growth factor 40; interleukin 9; interleukin-9; p40 cytokine; p40 T-cell and mast cell growth factor; P40; T-cell growth factor P40
Molecular Weight (g/mol)	12 to 24 kDa
Endotoxin Concentration	<0.10 EU per 1μg of the protein by the LAL method.
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
For Use With (Application)	Bioactivity
Source	Spodoptera frugiperda,Sf 21 (stably transfected)-derived human IL-9 protein Gln19-Ile144
Accession Number	P15248
Regulatory Status	RUO
Product Type	Recombinant protein
Biological Activity	0.03 to 0.3ng/mL
Gene ID (Entrez)	3578
Formulation	Lyophilized from a 0.2μm filtered solution in PBS with BSA as a carrier protein.
Species	Human
Recombinant	Recombinant

4,543

Novus Biologicals™ Centrin 3 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>95%
Conjugate	Unconjugated
Common Name	Centrin 3
Molecular Weight (g/mol)	21.7kDa
Formulation	Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol 0.1M NaCl
Immunogen	Human recombinant CETN3,1-167 aa. MGSSHHHHHHSSGLVPRGSHMSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human
Recombinant	Recombinant

4,544

R&D Systems™ Recombinant Cynomolgus B7-H7/HHLA2 Fc Chimera Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability

4,545

R&D Systems™ Recombinant Human Jagged 1 N-Terminal Fc Chimera Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability

Prev
1
...
301
302
303
304
...
7,717
Next

Welcome to fishersci.com

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ Recombinant Mouse DDT Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human GPT His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human PRAT4B/CNPY4 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Kallikrein 15 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Centrin 3 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Mouse DDT Protein

Novus Biologicals™ Recombinant Human GPT His Protein

Novus Biologicals™ Recombinant Human PRAT4B/CNPY4 His Protein

Novus Biologicals™ Recombinant Human Kallikrein 15 Protein

Novus Biologicals™ Centrin 3 Protein